SHOC2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis with SHOC2 polyclonal antibody (Cat # PAB30570).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Western Blot
Western Blot analysis with SHOC2 polyclonal antibody (Cat # PAB30570).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG sp
Lane 3: Human plasma (IgG/HSA depleted)
Lane 4: Human liver tissue
Lane 5: Human tonsil tissue
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with SHOC2 polyclonal antibody (Cat # PAB30570) shows moderate cytoplasmic positivity in cells in tubules.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with SHOC2 polyclonal antibody (Cat # PAB30570) shows positivity in cytoplasm and nucleus but excluded from the nucleoli. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human SHOC2.
Immunogen
Recombinant protein corresponding to amino acids 455-562 of human SHOC2.
Sequence
LEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500 - 1:1000)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C for short term storage. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis with SHOC2 polyclonal antibody (Cat # PAB30570).
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Western Blot
Western Blot analysis with SHOC2 polyclonal antibody (Cat # PAB30570).
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG sp
Lane 3: Human plasma (IgG/HSA depleted)
Lane 4: Human liver tissue
Lane 5: Human tonsil tissueImmunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with SHOC2 polyclonal antibody (Cat # PAB30570) shows moderate cytoplasmic positivity in cells in tubules.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with SHOC2 polyclonal antibody (Cat # PAB30570) shows positivity in cytoplasm and nucleus but excluded from the nucleoli. Antibody staining is shown in green. -
Gene Info — SHOC2
Entrez GeneID
8036Protein Accession#
Q9UQ13Gene Name
SHOC2
Gene Alias
FLJ60412, KIAA0862, SIAA0862, SOC-2, SOC2, SUR-8, SUR8
Gene Description
soc-2 suppressor of clear homolog (C. elegans)
Omim ID
602775Gene Ontology
HyperlinkGene Summary
C. elegans
Other Designations
OTTHUMP00000020481|soc-2 suppressor of clear homolog|suppressor of clear, C. elegans, homolog of
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com