PSAP polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis with PSAP polyclonal antibody (Cat # PAB30237) at 1:100 - 1:250 dilution
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG sp
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with PSAP polyclonal antibody (Cat # PAB30237) shows strong cytoplasmic positivity with a granular pattern in cells of tubules at 1:200 - 1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with PSAP polyclonal antibody (Cat # PAB30237) shows positivity in vesicles under 1-4 ug/mL concentration. Antibody staining is shown in green.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant human PSAP.
Immunogen
Recombinant protein corresponding to amino acids of human PSAP.
Sequence
TNSTFVQALVEHVKEECDRLGPGMADICKNYISQYSEIAIQMMMHMQPKEICALVGFCDEVKEMPMQTLVPAKVASKNVIPALELVEPIKKHEVPAKSDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEE
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot (Cell lysate) analysis with PSAP polyclonal antibody (Cat # PAB30237) at 1:100 - 1:250 dilution
Lane 1: Human cell line RT-4
Lane 2: Human cell line U-251MG spImmunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human kidney with PSAP polyclonal antibody (Cat # PAB30237) shows strong cytoplasmic positivity with a granular pattern in cells of tubules at 1:200 - 1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with PSAP polyclonal antibody (Cat # PAB30237) shows positivity in vesicles under 1-4 ug/mL concentration. Antibody staining is shown in green. -
Gene Info — PSAP
Entrez GeneID
5660Protein Accession#
P07602Gene Name
PSAP
Gene Alias
FLJ00245, GLBA, MGC110993, SAP1
Gene Description
prosaposin
Gene Ontology
HyperlinkGene Summary
This gene encodes a highly conserved glycoprotein which is a precursor for 4 cleavage products: saposins A, B, C, and D. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities. Mutations in this gene have been associated with Gaucher disease, Tay-Sachs disease, and metachromatic leukodystrophy. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000019776|sphingolipid activator protein-1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com