PDCD4 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of human RT-4 cell line with PDCD4 polyclonal antibody (Cat # PAB30214).
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH/3T3 cell lysate, Lane 2: NBT-II cell lysate, and Lane 3: PC-12 cell lysate with PDCD4 polyclonal antibody (Cat # PAB30214).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human breast shows strong cytoplasmic positivity in glandular cells with PDCD4 polyclonal antibody (Cat # PAB30214).
-
Specification
Product Description
Rabbit polyclonal antibody raised against partial recombinant human PDCD4.
Immunogen
Recombinant protein corresponding to amino acids 230 - 330 of human PDCD4.
Sequence
VMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKE
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500 - 1:1000)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of human RT-4 cell line with PDCD4 polyclonal antibody (Cat # PAB30214).Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH/3T3 cell lysate, Lane 2: NBT-II cell lysate, and Lane 3: PC-12 cell lysate with PDCD4 polyclonal antibody (Cat # PAB30214).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human breast shows strong cytoplasmic positivity in glandular cells with PDCD4 polyclonal antibody (Cat # PAB30214). -
Gene Info — PDCD4
Entrez GeneID
27250Protein Accession#
Q53EL6Gene Name
PDCD4
Gene Alias
H731, MGC33046, MGC33047
Gene Description
programmed cell death 4 (neoplastic transformation inhibitor)
Omim ID
608610Gene Ontology
HyperlinkGene Summary
This gene encodes a protein localized to the nucleus in proliferating cells. Expression of this gene is modulated by cytokines in natural killer and T cells. The gene product is thought to play a role in apoptosis but the specific role has not yet been determined. Two transcripts encoding different isoforms have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000020483|nuclear antigen H731|programmed cell death 4
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com