APOB polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot
Western Blot analysis of Lane 1: RT-4 cell lysate, Lane 2: U-251 MG, Lane 3: Human plasma, Lane 4: Human Liver tissue, Lane 5: Human Tonsil tissue with APOB polyclonal antibody (Cat# PAB29501) at 1:250 - 1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human duodenum with APOB polyclonal antibody (Cat# PAB29501) shows distinct positivity in plasma at 1:500 - 1:1000 dilution.
Immunofluorescence
Immunofluorescent staining of Hep G2 cells with APOB polyclonal antibody (Cat# PAB29501) under 1-4 ug/mL working concentration shows positivity in cytoplasm. Antibody staining is shown in green.
-
Specification
Product Description
APOB polyclonal antibody raised against recombinant human APOB.
Immunogen
Recombinant protein corresponding to amino acids of human APOB.
Sequence
NFVASHIANILNSEELDIQDLKKLVKEALKESQLPTVMDFRKFSRNYQLYKSVSLPSLDPASAKIEGNLIFDPNNYLPKESMLKTTLTAFGFASADLIE
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot
Western Blot analysis of Lane 1: RT-4 cell lysate, Lane 2: U-251 MG, Lane 3: Human plasma, Lane 4: Human Liver tissue, Lane 5: Human Tonsil tissue with APOB polyclonal antibody (Cat# PAB29501) at 1:250 - 1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human duodenum with APOB polyclonal antibody (Cat# PAB29501) shows distinct positivity in plasma at 1:500 - 1:1000 dilution.Immunofluorescence
Immunofluorescent staining of Hep G2 cells with APOB polyclonal antibody (Cat# PAB29501) under 1-4 ug/mL working concentration shows positivity in cytoplasm. Antibody staining is shown in green. -
Gene Info — APOB
Entrez GeneID
338Protein Accession#
P04114Gene Name
APOB
Gene Alias
FLDB
Gene Description
apolipoprotein B (including Ag(x) antigen)
Gene Ontology
HyperlinkGene Summary
This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the hepatic forms of apoB are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in this gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective apoB, diseases affecting plasma cholesterol and apoB levels. [provided by RefSeq
Other Designations
OTTHUMP00000115994|apoB-100|apoB-48|apolipoprotein B|apolipoprotein B48
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com