PSMD5 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
with PSMD5 polyclonal antibody (Cat # PAB28719) at 1:100-1:500 dilution.
Immunohistochemistry
Immunohistochemical staining of human prostate with PSMD5 polyclonal antibody (Cat # PAB28719) shows strong strong nuclear positivity in glandular cells at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with PSMD5 polyclonal antibody (Cat # PAB28719) at 1-4 ug/mL dilution shows positivity in nucleus and cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant PSMD5.
Immunogen
Recombinant protein corresponding to amino acids of human PSMD5.
Sequence
AAQALALLREVARLEAPLEELRALHSVLQAVPLNELRQQAAELRLGPLFSLLNENHREKTTLCVSILERLLQAMEPVHVARNLRVDLQRGLIHPDDSVKILTLSQIGRIVENSDAVTEILNNAELLKQIVYCIGGENLS
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:500)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
with PSMD5 polyclonal antibody (Cat # PAB28719) at 1:100-1:500 dilution.Immunohistochemistry
Immunohistochemical staining of human prostate with PSMD5 polyclonal antibody (Cat # PAB28719) shows strong strong nuclear positivity in glandular cells at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with PSMD5 polyclonal antibody (Cat # PAB28719) at 1-4 ug/mL dilution shows positivity in nucleus and cytoplasm. -
Gene Info — PSMD5
Entrez GeneID
5711Gene Name
PSMD5
Gene Alias
KIAA0072, MGC23145, S5B
Gene Description
proteasome (prosome, macropain) 26S subunit, non-ATPase, 5
Omim ID
604452Gene Ontology
HyperlinkGene Summary
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a non-ATPase subunit of the 19S regulator base. [provided by RefSeq
Other Designations
26S protease subunit S5 basic|26S proteasome non-ATPase regulatory subunit 5|26S proteasome subunit S5B|OTTHUMP00000021990|proteasome 26S non-ATPase subunit 5
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com