TJP2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with TJP2 polyclonal antibody at 1:100-1:500 dilution.
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with TJP2 polyclonal antibody at 1:100-1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human colon with TJP2 polyclonal antibody (Cat # PAB28487) shows moderate cytoplasmic and membranous positivity in glandular cells at 1:50-1:200 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with TJP2 polyclonal antibody (Cat # PAB28487) at 1-4 ug/ml shows positivity in plasma membrane, cytoplasm & cell junctions.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant TJP2.
Immunogen
Recombinant protein corresponding to amino acids of human TJP2
Sequence
IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMG
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with TJP2 polyclonal antibody at 1:100-1:500 dilution.Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with TJP2 polyclonal antibody at 1:100-1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human colon with TJP2 polyclonal antibody (Cat # PAB28487) shows moderate cytoplasmic and membranous positivity in glandular cells at 1:50-1:200 dilution.Immunofluorescence
Immunofluorescent staining of human cell line U-2 OS with TJP2 polyclonal antibody (Cat # PAB28487) at 1-4 ug/ml shows positivity in plasma membrane, cytoplasm & cell junctions. -
Gene Info — TJP2
Entrez GeneID
9414Protein Accession#
F5H301Gene Name
TJP2
Gene Alias
MGC26306, X104, ZO-2, ZO2
Gene Description
tight junction protein 2 (zona occludens 2)
Gene Ontology
HyperlinkGene Summary
Tight junction proteins (TJPs) belong to a family of membrane-associated guanylate kinase (MAGUK) homologs that are involved in the organization of epithelial and endothelial intercellular junctions. TJPs bind to the cytoplasmic C termini of junctional transmembrane proteins and link them to the actin cytoskeleton.[supplied by OMIM
Other Designations
Friedreich ataxia region gene X104 (tight junction protein ZO-2)|OTTHUMP00000021431|OTTHUMP00000063359
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com