MRPS24 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of cell lysates with MRPS24 polyclonal antibody ( Cat # PAB28022 ) at 1:100-1:500 dilution.
Lane 1: NIH-3T3
Lane 2: NBT-II
Western Blot
Western blot analysis of Lane 1: RT-4 Lane 2: U-251 MG Lane 3: Human Plasma Lane 4: Liver Lane 5: Tonsil with MRPS24 polyclonal antibody ( Cat # PAB28022 ) at 1:100 - 1:250 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human colon with MRPS24 polyclonal antibody ( Cat # PAB28022 ) shows strong cytoplasmic positivity in goblet cells at 1:20 - 1:50 dilution.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant MRPS24.
Immunogen
Recombinant protein corresponding to amino acids of human MRPS24
Sequence
GTFPGCLADQLVLKRRGNQLEICAVVLRQLSPHKYYFLVGYSETLLSYFYKCPVRLHLQTVPSKVVYKY
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:20 - 1:50)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2, (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with MRPS24 polyclonal antibody ( Cat # PAB28022 ) at 1:100-1:500 dilution.
Lane 1: NIH-3T3
Lane 2: NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4 Lane 2: U-251 MG Lane 3: Human Plasma Lane 4: Liver Lane 5: Tonsil with MRPS24 polyclonal antibody ( Cat # PAB28022 ) at 1:100 - 1:250 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human colon with MRPS24 polyclonal antibody ( Cat # PAB28022 ) shows strong cytoplasmic positivity in goblet cells at 1:20 - 1:50 dilution. -
Gene Info — MRPS24
Entrez GeneID
64951Gene Name
MRPS24
Gene Alias
HSPC335, MRP-S24
Gene Description
mitochondrial ribosomal protein S24
Gene Ontology
HyperlinkGene Summary
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. A pseudogene corresponding to this gene is found on chromosome 11. [provided by RefSeq
Other Designations
mitochondrial 28S ribosomal protein S24
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com