NFKB2 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western blot analysis of cell lysates with NFKB2 polyclonal antibody (Cat # PAB20425) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-II
Western Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with NFKB2 polyclonal antibody (Cat # PAB20425) at 1:250-1:500 dilution.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human lymph node with NFKB2 polyclonal antibody (Cat # PAB20425) shows strong cytoplasmic positivity in reaction center cells at 1:20-1:50 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with NFKB2 polyclonal antibody (Cat # PAB20425) at 1-4 ug/mL dilution shows positivity in cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant NFKB2.
Immunogen
Recombinant protein corresponding to amino acids of human NFKB2.
Sequence
LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA
Host
Rabbit
Reactivity
Human, Mouse, Rat
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western blot analysis of cell lysates with NFKB2 polyclonal antibody (Cat # PAB20425) at 1:250-1:500 dilution.
Lane 1 : NIH/3T3
Lane 2 : NBT-IIWestern Blot
Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with NFKB2 polyclonal antibody (Cat # PAB20425) at 1:250-1:500 dilution.Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human lymph node with NFKB2 polyclonal antibody (Cat # PAB20425) shows strong cytoplasmic positivity in reaction center cells at 1:20-1:50 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with NFKB2 polyclonal antibody (Cat # PAB20425) at 1-4 ug/mL dilution shows positivity in cytoplasm. -
Gene Info — NFKB2
Entrez GeneID
4791Protein Accession#
Q00653Gene Name
NFKB2
Gene Alias
LYT-10, LYT10
Gene Description
nuclear factor of kappa light polypeptide gene enhancer in B-cells 2 (p49/p100)
Omim ID
164012Gene Ontology
HyperlinkGene Summary
NFKB has been detected in numerous cell types that express cytokines, chemokines, growth factors, cell adhesion molecules, and some acute phase proteins in health and in various disease states. NFKB is activated by a wide variety of stimuli such as cytokines, oxidant-free radicals, inhaled particles, ultraviolet irradiation, and bacterial or viral products. Inappropriate activation of NF-kappa-B has been linked to inflammatory events associated with autoimmune arthritis, asthma, septic shock, lung fibrosis, glomerulonephritis, atherosclerosis, and AIDS. In contrast, complete and persistent inhibition of NF-kappa-B has been linked directly to apoptosis, inappropriate immune cell development, and delayed cell growth. For reviews, see Chen et al. (1999) [PubMed 9895331] and Baldwin (1996) [PubMed 8717528].[supplied by OMIM
Other Designations
OTTHUMP00000020371|OTTHUMP00000059136|nuclear factor of kappa light chain gene enhancer in B-cells 2|nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com