RPL3 polyclonal antibody
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebral cortex with RPL3 polyclonal antibody (Cat # PAB20200) shows strong cytoplasmic and nuclear(nucleolar) positivity in neuronal cells at 1:200-1:500 dilution.
Immunofluorescence
Immunofluorescent staining of human cell line A-431 with RPL3 polyclonal antibody (Cat # PAB20200) at 1-4 ug/mL dilution shows positivity in cytoplasm.
-
Specification
Product Description
Rabbit polyclonal antibody raised against recombinant RPL3.
Immunogen
Recombinant protein corresponding to amino acids of human RPL3.
Sequence
EDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHR
Host
Rabbit
Reactivity
Human
Form
Liquid
Purification
Antigen affinity purification
Isotype
IgG
Recommend Usage
Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining of human cerebral cortex with RPL3 polyclonal antibody (Cat # PAB20200) shows strong cytoplasmic and nuclear(nucleolar) positivity in neuronal cells at 1:200-1:500 dilution.Immunofluorescence
Immunofluorescent staining of human cell line A-431 with RPL3 polyclonal antibody (Cat # PAB20200) at 1-4 ug/mL dilution shows positivity in cytoplasm. -
Gene Info — RPL3
Entrez GeneID
6122Protein Accession#
P39023Gene Name
RPL3
Gene Alias
MGC104284, TARBP-B
Gene Description
ribosomal protein L3
Omim ID
604163Gene Ontology
HyperlinkGene Summary
Ribosomes, the complexes that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L3P family of ribosomal proteins and it is located in the cytoplasm. The protein can bind to the HIV-1 TAR mRNA, and it has been suggested that the protein contributes to tat-mediated transactivation. This gene is co-transcribed with several small nucleolar RNA genes, which are located in several of this gene's introns. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq
Other Designations
60S ribosomal protein L3|HIV-1 TAR RNA-binding protein B|OTTHUMP00000028935|ribosomal protein L3, isoform a
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com