IGSF11 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Surface Plasmon Resonance
Human B7-H5, hFc Tag captured on CM5 Chip via Protein A can bind Human IGSF11, His Tag with an affinity constant of 14.44 uM as determined in SPR assay (Biacore T200).
SEC-HPLC
The purity of Human IGSF11 is greater than 95% as determined by SEC-HPLC.
Tris-Bis PAGE
Human IGSF11 on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.
-
Specification
Product Description
Human IGSF11 (Q5DX21-1, 23 a.a. - 241 a.a.) partial recombinant protein with His tag at C-terminus expressed in HEK293 cells.
Sequence
LEVSESPGSIQVARGQPAVLPCTFTTSAALINLNVIWMVTPLSNANQPEQVILYQGGQMFDGAPRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQCLVNNLPDIGGRNIGVTGLTVLVPPSAPHCQIQGSQDIGSDVILLCSSEEGIPRPTYLWEKLDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRNIG
Host
Human
Theoretical MW (kDa)
24.31
Form
Lyophilized
Preparation Method
Mammalian cell (Expi293, high-yield transient HEK293) expression system
Purity
> 95% as determined by Tris-Bis PAGE; > 95% as determined by HPLC
Endotoxin Level
< 1 EU per 1 ug of protein (determined by LAL method)
Activity
The affinity constant of 14.44 uM as determined in SPR assay (Biacore T200).
Quality Control Testing
SEC-HPLC and Tris-Bis PAGE
SEC-HPLC
The purity of Human IGSF11 is greater than 95% as determined by SEC-HPLC.
Tris-Bis PAGE
Human IGSF11 on Tris-Bis PAGE under reduced condition. The purity is greater than 95%.
Recommend Usage
Biological Activity
SDS-PAGE
The optimal working dilution should be determined by the end user.Storage Buffer
Lyophilized from sterile distilled Water is > 100 ug/mL
Storage Instruction
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing.Note
Result of bioactivity analysis
-
Applications
Functional Study
SDS-PAGE
Surface Plasmon Resonance
Human B7-H5, hFc Tag captured on CM5 Chip via Protein A can bind Human IGSF11, His Tag with an affinity constant of 14.44 uM as determined in SPR assay (Biacore T200). -
Gene Info — IGSF11
Entrez GeneID
152404Protein Accession#
Q5DX21-1Gene Name
IGSF11
Gene Alias
BT-IgSF, CXADRL1, Igsf13, MGC35227, VSIG3
Gene Description
immunoglobulin superfamily, member 11
Omim ID
608351Gene Ontology
HyperlinkGene Summary
IGSF11 is an immunoglobulin (Ig) superfamily member that is preferentially expressed in brain and testis. It shares significant homology with coxsackievirus and adenovirus receptor (CXADR; MIM 602621) and endothelial cell-selective adhesion molecule (ESAM).[supplied by OMIM
Other Designations
CXADR like 1|V-set and immunoglobulin domain containing 3|brain and testis-specific immunoglobin superfamily protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com