TNFSF9 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TNFSF9 recombinant protein with polyhistidine tag at the C-terminus expressed in Escherichia coli.
Sequence
MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Host
Escherichia coli
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Purification
Ni-NTA chromatography
Purity
> 95% by SDS-PAGE
Endotoxin Level
< 0.1 EU per 1 ug of the protein by the LAL method.
Activity
Measured by the induction of IL-8 secretion in human PBMCs. The ED 50 for this effect is 1-5 ng/mL.
Quality Control Testing
SDS-PAGE Stained with Coomassie Blue
Recommend Usage
SDS-PAGE
The optimal working dilution should be determined by the end user.Storage Buffer
Lyophilized from PBS, pH 7.4.
Storage Instruction
Store at -20°C, lyophilized protein is stable for 1 year.
After reconstitution with deionized water, store at -20 to -80°C.
Aliquot to avoid repeated freezing and thawing. -
Applications
Functional Study
The ED50 for this effect is 1-5 ng/mL, measured by the induction of IL-8 secretion in human PBMCs.SDS-PAGE
-
Gene Info — TNFSF9
Entrez GeneID
8744Gene Name
TNFSF9
Gene Alias
4-1BB-L, CD137L
Gene Description
tumor necrosis factor (ligand) superfamily, member 9
Omim ID
606182Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction
Other Designations
homolog of mouse 4-1BB-L|receptor 4-1BB ligand
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com