STAT3 monoclonal antibody, clone CL0490
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human STAT3.
Immunogen
Recombinant protein corresponding to human STAT3.
Epitope
This antibody binds to an epitope located within the peptide sequence TKFICVTPTTCSNTI as determined by overlapping synthetic peptides.
Sequence
GVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECA
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG1
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of RT-4 cell lysate with STAT3 monoclonal antibody, clone CL0490 (Cat # MAB15635).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human prostate with STAT3 monoclonal antibody, clone CL0490 (Cat # MAB15635) shows strong nuclear and moderate cytoplasmic immunoreactivity in tumor cells. -
Gene Info — STAT3
Entrez GeneID
6774Protein Accession#
P40763Gene Name
STAT3
Gene Alias
APRF, FLJ20882, HIES, MGC16063
Gene Description
signal transducer and activator of transcription 3 (acute-phase response factor)
Omim ID
102582Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. Three alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq
Other Designations
DNA-binding protein APRF|acute-phase response factor|signal transducer and activator of transcription 3
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Nuclear receptor NR5A2 controls neural stem cell fate decisions during development.
Stergiopoulos A, Politis PK.
Nature Communications 2016 Jul; 7:12230.
Application:IF, Mouse, Mouse spinal cords, Mouse neural stem/progenitor cells.
-
Nuclear receptor NR5A2 controls neural stem cell fate decisions during development.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com