ATAD2 monoclonal antibody, clone CL0182
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human ATAD2.
Immunogen
Recombinant protein corresponding to human ATAD2.
Epitope
This antibody binds to an epitope located within the peptide sequence VGDKRSDPEQ as determined by overlapping synthetic peptides.
Sequence
TAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHK
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG1
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of Lane 1: over-expression lysate (co-expressed with a C-terminal myc-DDK tag in mammalian HEK293T cells), Lane 2: negative control (vector only transfected HEK293T cell lysate) and Lane 3: U-251 cell lysate with ATAD2 monoclonal antibody, clone CL0182 (Cat # MAB15553).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human testis with ATAD2 monoclonal antibody, clone CL0182 (Cat # MAB15553) shows strong nuclear positivity in seminiferous tubules. -
Gene Info — ATAD2
Entrez GeneID
29028Protein Accession#
Q6PL18Gene Name
ATAD2
Gene Alias
ANCCA, DKFZp667N1320, MGC131938, MGC142216, MGC29843, MGC5254, PRO2000
Gene Description
ATPase family, AAA domain containing 2
Gene Ontology
HyperlinkGene Summary
A large family of ATPases has been described, whose key feature is that they share a conserved region of about 220 amino acids that contains an ATP-binding site. The proteins that belong to this family either contain one or two AAA (ATPases Associated with diverse cellular Activities) domains. AAA family proteins often perform chaperone-like functions that assist in the assembly, operation, or disassembly of protein complexes. The protein encoded by this gene contains two AAA domains, as well as a bromodomain. [provided by RefSeq
Other Designations
-
-
Interactome
-
Publication Reference
-
ATAD2 is highly expressed in ovarian carcinomas and indicates poor prognosis.
Wan WN, Zhang YX, Wang XM, Liu YJ, Zhang YQ, Que YH, Zhao WJ.
Asian Pacific Journal of Cancer Prevention 2014 Jan; 15(6):2777.
Application:IHC-P, WB-Ti, Human, Human ovarian Carcinomas.
-
ATAD2 is highly expressed in ovarian carcinomas and indicates poor prognosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com