ADAR monoclonal antibody, clone CL0176
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
Western Blot analysis of U-251 MG cell lysate with ADAR monoclonal antibody, clone CL0176 (Cat # MAB15551).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with ADAR monoclonal antibody, clone CL0176 (Cat # MAB15551) shows nuclear positivity.
-
Specification
Product Description
Mouse monoclonal antibody raised against partial recombinant human ADAR.
Immunogen
Recombinant protein corresponding to human ADAR.
Sequence
SDNQPEGMISESLDNLESMMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEA
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG1
Recommend Usage
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
-
Applications
Western Blot (Cell lysate)
Western Blot analysis of U-251 MG cell lysate with ADAR monoclonal antibody, clone CL0176 (Cat # MAB15551).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human cerebral cortex with ADAR monoclonal antibody, clone CL0176 (Cat # MAB15551) shows nuclear positivity. -
Gene Info — ADAR
Entrez GeneID
103Protein Accession#
P55265Gene Name
ADAR
Gene Alias
ADAR1, DRADA, DSH, DSRAD, G1P1, IFI-4, IFI4, K88dsRBP, p136
Gene Description
adenosine deaminase, RNA-specific
Gene Ontology
HyperlinkGene Summary
This gene encodes the enzyme responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
Other Designations
136 kDa double-stranded RNA binding protein|OTTHUMP00000035372|OTTHUMP00000035373|adenosine deaminase acting on RNA 1-A|double-stranded RNA-specific adenosine deaminase|interferon-induced protein 4|interferon-inducible protein 4
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Gene amplification-associated overexpression of the RNA editing enzyme ADAR1 enhances human lung tumorigenesis.
Anadon C, Guil S, Simo-Riudalbas L, Moutinho C, Setien F, Martinez-Cardus A, Moran S, Villanueva A, Calaf M, Vidal A, Lazo PA, Zondervan I, Savola S, Kohno T, Yokota J, Ribas de Pouplana L, Esteller M.
Oncogene 2016 Aug; 35(33):4407.
Application：IF, IHC, WB-Ce, Human, A-549, Cal12T, H1395, H1437, H1993, HBEC3KT cells, Human lung cancer tissues.
-
Gene amplification-associated overexpression of the RNA editing enzyme ADAR1 enhances human lung tumorigenesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com