SALF (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human SALF partial ORF ( NP_758515, 141 a.a. - 249 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
SCTHPTPKVGLPDEVNPQQAESLGFQSDDLPQFQYFREDCAFSSPFWKDEGSDSHFTLDPPGSKKMFSSRNKEMPIDQKSLNKCSLNYICEKLEHLQSAENQDSLRSLS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.73
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — STON1-GTF2A1L
Entrez GeneID
286749GeneBank Accession#
NM_172311Protein Accession#
NP_758515Gene Name
STON1-GTF2A1L
Gene Alias
MGC126821, MGC126823, SALF
Gene Description
STON1-GTF2A1L readthrough transcript
Gene Ontology
HyperlinkGene Summary
The STON1-GTF2A1L mRNA is an infrequent but naturally occurring co-transcribed product of the neighboring STON1 and GTF2A1L genes. This rare transcript encodes a fusion protein composed of greater than 95% each of the individual elements, stonin 1 and general transcription factor IIA, 1-like. The significance of this co-transcribed mRNA and the function of its protein product have not yet been determined. [provided by RefSeq
Other Designations
OTTHUMP00000159452|STON1-GTF2A1L protein|stoned B/TFIIA alpha/beta like factor|stoned B/TFIIA-alpha/beta-like factor
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com