MAGEB6 monoclonal antibody (M02), clone 2C11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of MAGEB6 expression in transfected 293T cell line by MAGEB6 monoclonal antibody (M02), clone 2C11.
Lane 1: MAGEB6 transfected lysate(44 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAGEB6 is 0.03 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAGEB6.
Immunogen
MAGEB6 (NP_775794.2, 135 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SPSTSHDVSVPQESQGASPTGSPDAGVSGSKYDVAAEGEDEESVSASQKAIIFKRLSKDAVKKKACTLAQFLQKKFEKKESILKADMLKCVRREYKPYFPQILNRTSQHL
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of MAGEB6 expression in transfected 293T cell line by MAGEB6 monoclonal antibody (M02), clone 2C11.
Lane 1: MAGEB6 transfected lysate(44 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MAGEB6 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — MAGEB6
Entrez GeneID
158809GeneBank Accession#
NM_173523Protein Accession#
NP_775794.2Gene Name
MAGEB6
Gene Alias
FLJ40242, MAGE-B6, MAGEB6A
Gene Description
melanoma antigen family B, 6
Omim ID
300467Gene Ontology
HyperlinkGene Summary
This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. This gene is expressed in testis, and in a significant fraction of tumors of various histological types. The MAGEB genes are clustered on chromosome Xp22-p21. [provided by RefSeq
Other Designations
OTTHUMP00000023093
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com