WFDC6 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human WFDC6 full-length ORF ( NP_543017.1, 1 a.a. - 86 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MGLSGLLPILVPFILLGDIQEPGHAEGILGKPCPKIKVECEVEEIDQCTKPRDCPENMKCCPFSRGKKCLDFRKVSLTLYHKEELE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.1
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — WFDC6
Entrez GeneID
140870GeneBank Accession#
NM_080827.1Protein Accession#
NP_543017.1Gene Name
WFDC6
Gene Alias
C20orf171, MGC126649, MGC126653, WAP6, dJ461P17.11
Gene Description
WAP four-disulfide core domain 6
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. [provided by RefSeq
Other Designations
OTTHUMP00000043709|protease inhibitor WAP6
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com