ASB10 monoclonal antibody (M02), clone 1F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ASB10.
Immunogen
ASB10 (NP_001135931, 48 a.a. ~ 153 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSWSPEECKGQGEPLDDRHPLCARLVEKPSRGSEEHLKSGPGPIVTRTASGPALAFWQAVLAGDVGCVSRILADSSTGLAPDSVFDTSDPERWRDFRFNIRALRLW
Host
Mouse
Reactivity
Human, Mouse, Rat
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.4 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ASB10 monoclonal antibody (M02), clone 1F3. Western Blot analysis of ASB10 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
ASB10 monoclonal antibody (M02), clone 1F3. Western Blot analysis of ASB10 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
ASB10 monoclonal antibody (M02), clone 1F3 Western Blot analysis of ASB10 expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
ASB10 monoclonal antibody (M02), clone 1F3. Western Blot analysis of ASB10 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ASB10 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — ASB10
Entrez GeneID
136371GeneBank Accession#
NM_001142459Protein Accession#
NP_001135931Gene Name
ASB10
Gene Alias
-
Gene Description
ankyrin repeat and SOCS box-containing 10
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. The SOCS box serves to couple suppressor of cytokine signaling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com