PIGS monoclonal antibody (M02), clone 3F3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PIGS.
Immunogen
PIGS (NP_149975.1, 450 a.a. ~ 518 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GKISNIVIKDDVASEVYKAVAAVQKSAEELASGHLASAFVASQEAVTSSELAFFDPSLLHLLYFPDDQK
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (91); Rat (91)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (33.33 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PIGS monoclonal antibody (M02), clone 3F3. Western Blot analysis of PIGS expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PIGS is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — PIGS
Entrez GeneID
94005GeneBank Accession#
NM_033198Protein Accession#
NP_149975.1Gene Name
PIGS
Gene Alias
DKFZp686K20216, FLJ45226
Gene Description
phosphatidylinositol glycan anchor biosynthesis, class S
Omim ID
610271Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that is involved in GPI-anchor biosynthesis. The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes an essential component of the multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins. [provided by RefSeq
Other Designations
GPI transamidase subunit|phosphatidylinositol glycan, class S
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com