SCYL1BP1 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SCYL1BP1 protein.
Immunogen
SCYL1BP1 (AAH64945, 1 a.a. ~ 246 a.a) full-length human protein.
Sequence
MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNVQKPPFSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENSHDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRLMEEKNKRKKALLAKAIAERSKRTQAETMKLKRIQKELQALDDMVSADIGILRNRIDQASLDYSYAR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (84)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Tissue lysate)
SCYL1BP1 MaxPab polyclonal antibody. Western Blot analysis of SCYL1BP1 expression in human colon.Western Blot (Transfected lysate)
Western Blot analysis of SCYL1BP1 expression in transfected 293T cell line (H00092344-T01) by SCYL1BP1 MaxPab polyclonal antibody.
Lane 1: SCYL1BP1 transfected lysate(27.06 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to SCYL1BP1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SCYL1BP1
Entrez GeneID
92344GeneBank Accession#
BC064945Protein Accession#
AAH64945Gene Name
SCYL1BP1
Gene Alias
FLJ11752, MGC51263, MGC70512, NTKL-BP1, NTKLBP1, RP11-545I10.1
Gene Description
SCY1-like 1 binding protein 1
Omim ID
607983Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the golgin family, a group of coiled-coil proteins localized to the Golgi. The encoded protein may function in the secretory pathway. The encoded protein, which also localizes to the cytoplasm, was identified by interactions with the N-terminal kinase-like protein, and thus it may function in mitosis. Mutations in this gene have been associated with geroderma osteodysplastica. Alternatively spliced transcript variants have been described. [provided by RefSeq
Other Designations
NTKL-binding protein 1|OTTHUMP00000033164
-
Interactome
-
Publication Reference
-
SCYL1 binding protein 1 promotes the ubiquitin-dependent degradation of Pirh2 and has tumor-suppressive function in the development of hepatocellular carcinoma.
Hu L, Liu M, Chen L, Chan TH, Wang J, Huo KK, Zheng BJ, Xie D, Guan XY.
Carcinogenesis 2012 Aug; 33(8):1581.
Application:IHC-P, WB, Human, Human hepatocellular carcinoma.
-
SCYL1 binding protein 1 promotes the ubiquitin-dependent degradation of Pirh2 and has tumor-suppressive function in the development of hepatocellular carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com