RELT purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
RELT MaxPab rabbit polyclonal antibody. Western Blot analysis of RELT expression in mouse kidney.
Western Blot (Tissue lysate)
RELT MaxPab rabbit polyclonal antibody. Western Blot analysis of RELT expression in human pancreas.
Western Blot (Cell lysate)
RELT MaxPab rabbit polyclonal antibody. Western Blot analysis of RELT expression in HeLa.
Western Blot (Transfected lysate)
Western Blot analysis of RELT expression in transfected 293T cell line (H00084957-T02) by RELT MaxPab polyclonal antibody.
Lane 1: RELT transfected lysate(46.10 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to RELT on HeLa cell. [antibody concentration 20 ug/ml]
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human RELT protein.
Immunogen
RELT (NP_116260.2, 1 a.a. ~ 430 a.a) full-length human protein.
Sequence
MKPSLLCRPLSCFLMLLPWPLATLTSTTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRAGGPEETAAQYAVIAIVPVFCLMGLLGILVCNLLKRKGYHCTAHKEVGPGPGGGGSGINPAYRTEDANEDTIGVLVRLITEKKENAAALEELLKEYHSKQLVQTSHRPVSKLPPAPPNVPHICPHRHHLHTVQGLASLSGPCCSRCSQKKWPEVLLSPEAVAATTPVPSLLPNPTRVPKAGAKAGRQGEITILSVGRFRVARIPEQRTSSMVSEVKTITEAGPSWGDLPDSPQPGLPPEQQALLGSGGSRTKWLKPPAENKAEENRYVVRLSESNLVI
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
RELT MaxPab rabbit polyclonal antibody. Western Blot analysis of RELT expression in mouse kidney.Western Blot (Tissue lysate)
RELT MaxPab rabbit polyclonal antibody. Western Blot analysis of RELT expression in human pancreas.Western Blot (Cell lysate)
RELT MaxPab rabbit polyclonal antibody. Western Blot analysis of RELT expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of RELT expression in transfected 293T cell line (H00084957-T02) by RELT MaxPab polyclonal antibody.
Lane 1: RELT transfected lysate(46.10 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to RELT on HeLa cell. [antibody concentration 20 ug/ml] -
Gene Info — RELT
Entrez GeneID
84957GeneBank Accession#
NM_032871.3Protein Accession#
NP_116260.2Gene Name
RELT
Gene Alias
FLJ14993, TNFRSF19L
Gene Description
RELT tumor necrosis factor receptor
Omim ID
611211Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is especially abundant in hematologic tissues. It has been shown to activate the NF-kappaB pathway and selectively bind TNF receptor-associated factor 1 (TRAF1). This receptor is capable of stimulating T-cell proliferation in the presence of CD3 signaling, which suggests its regulatory role in immune response. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported. [provided by RefSeq
Other Designations
receptor expressed in lymphoid tissues|tumor necrosis factor receptor superfamily, member 19-like
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com