RNASEH2C monoclonal antibody (M02), clone 5D6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RNASEH2C expression in transfected 293T cell line by RNASEH2C monoclonal antibody (M02), clone 5D6.
Lane 1: RNASEH2C transfected lysate (Predicted MW: 17.8 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNASEH2C is 0.1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to RNASEH2C on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (44.2 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant RNASEH2C.
Immunogen
RNASEH2C (NP_115569.2, 1 a.a. ~ 164 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGATANFSRFTLWGLETIPGPDAKVRGALTWPSLAAAIHAQVPED
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (65)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (44.2 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RNASEH2C expression in transfected 293T cell line by RNASEH2C monoclonal antibody (M02), clone 5D6.
Lane 1: RNASEH2C transfected lysate (Predicted MW: 17.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged RNASEH2C is 0.1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to RNASEH2C on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — RNASEH2C
Entrez GeneID
84153GeneBank Accession#
NM_032193.3Protein Accession#
NP_115569.2Gene Name
RNASEH2C
Gene Alias
AGS3, AYP1, FLJ20974, MGC22934
Gene Description
ribonuclease H2, subunit C
Gene Ontology
HyperlinkGene Summary
This gene encodes a ribonuclease H subunit that can cleave ribonucleotides from RNA:DNA duplexes. Mutations in this gene cause Aicardi-Goutieres syndrome-3, a disease that causes severe neurologic dysfunction. A pseudogene for this gene has been identified on chromosome Y, near the sex determining region Y (SRY) gene. [provided by RefSeq
Other Designations
RNase H1 small subunit
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com