TGIF2 monoclonal antibody (M03), clone 5G1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TGIF2.
Immunogen
TGIF2 (NP_068581, 131 a.a. ~ 236 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENP
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.4 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
TGIF2 monoclonal antibody (M03), clone 5G1. Western Blot analysis of TGIF2 expression in SJCRH30 ( Cat # L027V1 ).Western Blot (Cell lysate)
TGIF2 monoclonal antibody (M03), clone 5G1. Western Blot analysis of TGIF2 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
TGIF2 monoclonal antibody (M03), clone 5G1 Western Blot analysis of TGIF2 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TGIF2 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — TGIF2
Entrez GeneID
60436GeneBank Accession#
NM_021809Protein Accession#
NP_068581Gene Name
TGIF2
Gene Alias
-
Gene Description
TGFB-induced factor homeobox 2
Omim ID
607294Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a DNA-binding homeobox protein and a transcriptional repressor. The encoded protein appears to repress transcription by recruiting histone deacetylases to TGF beta-responsive genes. This gene is amplified and overexpressed in some ovarian cancers, and mutations in this gene can cause holoprosencephaly. [provided by RefSeq
Other Designations
5'-TG-3' interacting factor 2|OTTHUMP00000030848|OTTHUMP00000030849|TGF(beta)-induced transcription factor 2|TGFB-induced factor 2 (TALE family homeobox)|homeobox protein TGIF2|transcription growth factor-beta-induced factor 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com