LRRC8A monoclonal antibody (M04), clone 8H9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant LRRC8A.
Immunogen
LRRC8A (NP_062540.2, 711 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
LRRC8A monoclonal antibody (M04), clone 8H9. Western Blot analysis of LRRC8A expression in A-431.Western Blot (Recombinant protein)
ELISA
-
Gene Info — LRRC8A
Entrez GeneID
56262GeneBank Accession#
NM_019594Protein Accession#
NP_062540.2Gene Name
LRRC8A
Gene Alias
FLJ10337, FLJ41617, KIAA1437, LRRC8
Gene Description
leucine rich repeat containing 8 family, member A
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. This family member is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000022308|OTTHUMP00000022309|leucine-rich repeat-containing protein 8A
-
Interactome
-
Publication Reference
-
LRRC8A anion channels modulate vascular reactivity via association with myosin phosphatase rho interacting protein.
Hyehun Choi, Michael R Miller, Hong-Ngan Nguyen, Jeffrey C Rohrbough, Stephen R Koch, Naoko Boatwright, Michael T Yarboro, Rajan Sah, W Hayes McDonald, J Jeffrey Reese, Ryan J Stark, Fred S Lamb.
FASEB Journal 2023 Jul; 37(7):e23028.
Application:PLA, Mouse, Mouse vascular smooth muscle cell.
-
LRRC8A anion channels modulate vascular reactivity via association with myosin phosphatase rho interacting protein.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com