FANCL purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human FANCL protein.
Immunogen
FANCL (NP_060532.2, 1 a.a. ~ 375 a.a) full-length human protein.
Sequence
MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIVQQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLGADHVVKPLGIKLSRNIHLWDPENSVLQNLKDVLEIDFPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNIIFGECPYCSKPITLKMSGRKH
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (79); Rat (79)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FANCL MaxPab rabbit polyclonal antibody. Western Blot analysis of FANCL expression in human spleen.Western Blot (Cell lysate)
FANCL MaxPab rabbit polyclonal antibody. Western Blot analysis of FANCL expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of FANCL expression in transfected 293T cell line (H00055120-T02) by FANCL MaxPab polyclonal antibody.
Lane 1: FANCL transfected lysate(42.90 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to FANCL on HeLa cell. [antibody concentration 30 ug/ml] -
Gene Info — FANCL
Entrez GeneID
55120GeneBank Accession#
NM_018062.2Protein Accession#
NP_060532.2Gene Name
FANCL
Gene Alias
FAAP43, FLJ10335, PHF9, POG
Gene Description
Fanconi anemia, complementation group L
Omim ID
608111Gene Ontology
HyperlinkGene Summary
The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group L. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
PHD finger protein 9
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com