UGT1A9 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant UGT1A9.
Immunogen
UGT1A9 (NP_066307, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag.
Sequence
KLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLGRSLNCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLFFSNCRSLFKDKKLVEY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (78); Rat (79)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — UGT1A9
Entrez GeneID
54600GeneBank Accession#
NM_021027Protein Accession#
NP_066307Gene Name
UGT1A9
Gene Alias
HLUGP4, LUGP4, UDPGT, UGT1AI
Gene Description
UDP glucuronosyltransferase 1 family, polypeptide A9
Omim ID
606434Gene Ontology
HyperlinkGene Summary
This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenols. [provided by RefSeq
Other Designations
UDP glycosyltransferase 1 family, polypeptide A9|UDP-glucuronosyltransferase 1A9
-
Interactome
-
Pathway
- Androgen and estrogen metabolism
- Ascorbate and aldarate metabolism
- Drug metabolism - cytochrome P450
- Drug metabolism - other enzymes
- Metabolic pathways
- Metabolism of xenobiotics by cytochrome P450
- Pentose and glucuronate interconversions
- Porphyrin and chlorophyll metabolism
- Retinol metabolism
+ View More Disease
-
Disease
-
Publication Reference
-
Preparation of a specific monoclonal antibody against human UDP-glucuronosyltransferase (UGT) 1A9 and evaluation of UGT1A9 protein levels in human tissues.
Oda S, Nakajima M, Hatakeyama M, Fukami T, Yokoi T.
Drug Metabolism and Disposition 2012 Aug; 40(8):1620.
Application:WB, Human, Mouse, Rat, HEK 293, HepG2, HLM, HK-2, MCF-7 cells, Livers from Human, Mouse, Rat.
-
Quantitative analysis of UGT1A and UGT2B expression levels in human livers.
Izukawa T, Nakajima M, Fujiwara R, Yamanaka H, Fukami T, Takamiya M, Aoki Y, Ikushiro SI, Sakaki T, Yokoi T.
Drug Metabolism and Disposition: the Biological Fate of Chemicals 2009 May; 37(8):1759.
Application:WB-Ti, Human, Human liver.
-
Preparation of a specific monoclonal antibody against human UDP-glucuronosyltransferase (UGT) 1A9 and evaluation of UGT1A9 protein levels in human tissues.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com