KCNK10 monoclonal antibody (M03), clone 1C1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KCNK10 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KCNK10.
Immunogen
KCNK10 (NP_066984, 439 a.a. ~ 538 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEKKEEETEKMCNSDNSSTAMLTDCIQQHAELENGMIPTDTKDREPENNSLLEDRN
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KCNK10 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — KCNK10
Entrez GeneID
54207GeneBank Accession#
NM_021161Protein Accession#
NP_066984Gene Name
KCNK10
Gene Alias
FLJ43399, K2p10.1, TREK-2, TREK2
Gene Description
potassium channel, subfamily K, member 10
Omim ID
605873Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the family of potassium channel proteins containing two pore-forming P domains. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations, and is stimulated strongly by arachidonic acid and to a lesser degree by membrane stretching, intracellular acidification, and general anaesthetics. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
2P domain potassium channel TREK2|TWIK-related K+ channel 2|outward rectifying potassium channel protein TREK-2|potassium channel TREK-2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com