PPIL1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PPIL1.
Immunogen
PPIL1 (NP_057143, 76 a.a. ~ 166 a.a) partial recombinant protein with GST tag.
Sequence
SIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSG
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (98); Rat (98)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.12 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PPIL1 polyclonal antibody (A01), Lot # 060524JCS1 Western Blot analysis of PPIL1 expression in K-562 ( Cat # L009V1 ).Western Blot (Cell lysate)
PPIL1 polyclonal antibody (A01), Lot # 060524JCS1. Western Blot analysis of PPIL1 expression in PC-12.Western Blot (Cell lysate)
PPIL1 polyclonal antibody (A01), Lot # 060524JCS1. Western Blot analysis of PPIL1 expression in NIH/3T3.Western Blot (Recombinant protein)
ELISA
-
Gene Info — PPIL1
Entrez GeneID
51645GeneBank Accession#
NM_016059Protein Accession#
NP_057143Gene Name
PPIL1
Gene Alias
CGI-124, CYPL1, MGC678, PPIase, hCyPX
Gene Description
peptidylprolyl isomerase (cyclophilin)-like 1
Omim ID
601301Gene Ontology
HyperlinkGene Summary
This gene is a member of the cyclophilin family of peptidylprolyl isomerases (PPIases). The cyclophilins are a highly conserved, ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions. Based on similarity to other PPIases, this protein could accelerate the folding of proteins and might catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. [provided by RefSeq
Other Designations
OTTHUMP00000016310|cyclophilin-related gene 1|peptidyl-prolyl cis-trans isomerase|peptidylprolyl isomerase-like 1|rotamase
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com