SFMBT1 monoclonal antibody (M02), clone 2A1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SFMBT1.
Immunogen
SFMBT1 (NP_057413, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EGIRDKVSDWDEFLRQTLIGACSPPVPLLEGLRNGRNPLDLIAPGSRLECQAFQDSLSTWIVTVVENIGGRLKLRYEGLESSDNYEHWLYYLDPFLHHVGWAAQQGYELQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (85)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.51 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SFMBT1 expression in transfected 293T cell line by SFMBT1 monoclonal antibody (M02), clone 2A1.
Lane 1: SFMBT1 transfected lysate(98.141 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged SFMBT1 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — SFMBT1
Entrez GeneID
51460GeneBank Accession#
NM_016329Protein Accession#
NP_057413Gene Name
SFMBT1
Gene Alias
DKFZp434L243, RU1, SFMBT
Gene Description
Scm-like with four mbt domains 1
Omim ID
607319Gene Ontology
HyperlinkGene Summary
This gene shares high similarity with the Drosophila Scm (sex comb on midleg) gene. It encodes a protein which contains four malignant brain tumor repeat (mbt) domains and may be involved in antigen recognition. Several alternative splice variants have been characterized. [provided by RefSeq
Other Designations
Scm-related gene containing four mbt domains|Scm-related gene product containing four mbt domains
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com