HPCAL4 monoclonal antibody (M01), clone 2B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of HPCAL4 expression in transfected 293T cell line by HPCAL4 monoclonal antibody (M01), clone 2B11.
Lane 1: HPCAL4 transfected lysate(22.2 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HPCAL4 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (46.75 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant HPCAL4.
Immunogen
HPCAL4 (AAH30827, 1 a.a. ~ 191 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRMNQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDASIVLLLQCDMQK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (98)
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (46.75 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of HPCAL4 expression in transfected 293T cell line by HPCAL4 monoclonal antibody (M01), clone 2B11.
Lane 1: HPCAL4 transfected lysate(22.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HPCAL4 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — HPCAL4
Entrez GeneID
51440GeneBank Accession#
BC030827Protein Accession#
AAH30827Gene Name
HPCAL4
Gene Alias
DKFZp761G122, HLP4
Gene Description
hippocalcin like 4
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is highly similar to human hippocalcin protein and hippocalcin like-1 protein. It also has similarity to rat neural visinin-like Ca2+-binding protein-type 1 and 2 proteins. This encoded protein may be involved in the calcium-dependent regulation of rhodopsin phosphorylation. The transcript of this gene has multiple polyadenylation sites. [provided by RefSeq
Other Designations
OTTHUMP00000010835|hippocalcin-like protein 4
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com