CDC40 MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CDC40 expression in transfected 293T cell line (H00051362-T01) by CDC40 MaxPab polyclonal antibody.
Lane 1: CDC40 transfected lysate(63.69 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CDC40 protein.
Immunogen
CDC40 (NP_056975, 1 a.a. ~ 579 a.a) full-length human protein.
Sequence
MSAAIAALAASYGSGSGSESDSDSESSRCPLPAADSLMHLTKSPSSKPSLAVAVDSAPEVAVKEDLETGVHLDPAVKEVQYNPTYETMFAPEFGPENPFRTQQMAAPRNMLSGYAEPAHINDFMFEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKKTEKRKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDGLIKLWD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (99)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CDC40 expression in transfected 293T cell line (H00051362-T01) by CDC40 MaxPab polyclonal antibody.
Lane 1: CDC40 transfected lysate(63.69 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CDC40
Entrez GeneID
51362GeneBank Accession#
NM_015891Protein Accession#
NP_056975Gene Name
CDC40
Gene Alias
EHB3, FLJ10564, MGC102802, PRP17, PRPF17
Gene Description
cell division cycle 40 homolog (S. cerevisiae)
Omim ID
605585Gene Ontology
HyperlinkGene Summary
Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to yeast Prp17 protein, which functions in two different cellular processes: pre-mRNA splicing and cell cycle progression. It suggests that this protein may play a role in cell cycle progression. [provided by RefSeq
Other Designations
EH-binding protein 3|OTTHUMP00000016997|cell division cycle 40 homolog|pre-mRNA splicing factor 17
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com