DBR1 monoclonal antibody (M01), clone 3A7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of DBR1 expression in transfected 293T cell line by DBR1 monoclonal antibody (M01), clone 3A7.
Lane 1: DBR1 transfected lysate(61.6 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DBR1 is 0.03 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to DBR1 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.08 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DBR1.
Immunogen
DBR1 (NP_057300.2, 445 a.a. ~ 538 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SGMNTPSVEPSDQASEFSASFSDVRILPGSMIVSSDDTVDSTIDREGKPGGTVESGNGEDLTKVPLKRLSDEHEPEQRKKIKRRNQAIYAAVDD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (85)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.08 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of DBR1 expression in transfected 293T cell line by DBR1 monoclonal antibody (M01), clone 3A7.
Lane 1: DBR1 transfected lysate(61.6 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DBR1 is 0.03 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to DBR1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — DBR1
Entrez GeneID
51163GeneBank Accession#
NM_016216Protein Accession#
NP_057300.2Gene Name
DBR1
Gene Alias
-
Gene Description
debranching enzyme homolog 1 (S. cerevisiae)
Omim ID
607024Gene Ontology
HyperlinkGene Summary
The RNA lariat debranching enzyme, or DBR1, specifically hydrolyzes 2-prime-to-5-prime branched phosphodiester bonds at the branch point of excised lariat intron RNA and converts them into linear molecules.[supplied by OMIM
Other Designations
RNA lariat debranching enzyme|debranching enzyme homolog 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com