ALG5 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ALG5 protein.
Immunogen
ALG5 (NP_037470.1, 1 a.a. ~ 324 a.a) full-length human protein.
Sequence
MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (91); Rat (92)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ALG5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALG5 expression in human pancreas.Western Blot (Tissue lysate)
ALG5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALG5 expression in mouse lung.Western Blot (Cell lysate)
ALG5 MaxPab rabbit polyclonal antibody. Western Blot analysis of ALG5 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of ALG5 expression in transfected 293T cell line (H00029880-T01) by ALG5 MaxPab polyclonal antibody.
Lane 1: ALG5 transfected lysate(36.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ALG5
Entrez GeneID
29880GeneBank Accession#
NM_013338.3Protein Accession#
NP_037470.1Gene Name
ALG5
Gene Alias
RP11-421P11.2, bA421P11.2
Gene Description
asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae)
Omim ID
604565Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the glycosyltransferase 2 family. The encoded protein participates in glucosylation of the oligomannose core in N-linked glycosylation of proteins. The addition of glucose residues to the oligomannose core is necessary to ensure substrate recognition, and therefore, effectual transfer of the oligomannose core to the nascent glycoproteins. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
Alg5, S. cerevisiae, homolog of|OTTHUMP00000042273|asparagine-linked glycosylation 5 homolog (S. cerevisiae, dolichyl-phosphate beta-glucosyltransferase)|asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphate beta-glucosyltransferase)|dolich
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com