PYCARD purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PYCARD protein.
Immunogen
PYCARD (AAH13569, 1 a.a. ~ 149 a.a) full-length human protein.
Sequence
MDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFNFTPAWNWTCKDLLLQALRESQSYLVEDLERS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (71); Rat (69)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PYCARD MaxPab polyclonal antibody. Western Blot analysis of PYCARD expression in human kidney.Western Blot (Tissue lysate)
PYCARD MaxPab polyclonal antibody. Western Blot analysis of PYCARD expression in human spleen.Western Blot (Cell lysate)
PYCARD MaxPab polyclonal antibody. Western Blot analysis of PYCARD expression in MCF-7.Western Blot (Transfected lysate)
Western Blot analysis of PYCARD expression in transfected 293T cell line (H00029108-T01) by PYCARD MaxPab polyclonal antibody.
Lane 1: PYCARD transfected lysate(16.5 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PYCARD
Entrez GeneID
29108GeneBank Accession#
BC013569Protein Accession#
-Gene Name
PYCARD
Gene Alias
ASC, CARD5, MGC10332, TMS, TMS-1, TMS1
Gene Description
PYD and CARD domain containing
Omim ID
606838Gene Ontology
HyperlinkGene Summary
This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing apoptosis, it forms ball-like aggregates near the nuclear periphery. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
apoptosis-associated speck-like protein containing a CARD|caspase recruitment domain protein 5|target of methylation-induced silencing-1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com