FBXL3 monoclonal antibody (M03), clone 1A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FBXL3.
Immunogen
FBXL3 (NP_036290, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIK
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FBXL3 monoclonal antibody (M03), clone 1A3. Western Blot analysis of FBXL3 expression in PC-12(Cat # L012V1 ).Western Blot (Cell lysate)
FBXL3 monoclonal antibody (M03), clone 1A3. Western Blot analysis of FBXL3 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
FBXL3 monoclonal antibody (M03), clone 1A3. Western Blot analysis of FBXL3 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FBXL3 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — FBXL3
Entrez GeneID
26224GeneBank Accession#
NM_012158Protein Accession#
NP_036290Gene Name
FBXL3
Gene Alias
FBL3, FBL3A, FBXL3A
Gene Description
F-box and leucine-rich repeat protein 3
Omim ID
605653Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats and is localized in the nucleus. [provided by RefSeq
Other Designations
F-box and leucine-rich repeat protein 3A|F-box protein Fbl3a|OTTHUMP00000018519
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com