APPL polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
APPL polyclonal antibody (A01), Lot # HRI0060508QCS1. Western Blot analysis of APPL expression in NIH/3T3.
Western Blot (Cell lysate)
APPL polyclonal antibody (A01), Lot # HRI0060508QCS1 Western Blot analysis of APPL expression in HeLa ( Cat # L013V1 ).
Western Blot detection against Immunogen (36.89 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant APPL.
Immunogen
APPL (NP_036228, 611 a.a. ~ 708 a.a) partial recombinant protein with GST tag.
Sequence
EGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQSRLIAASSRPNQASSEGQFVVLSSSQSEESDLGEGGKKRESE
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (93)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.89 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
APPL polyclonal antibody (A01), Lot # HRI0060508QCS1. Western Blot analysis of APPL expression in NIH/3T3.Western Blot (Cell lysate)
APPL polyclonal antibody (A01), Lot # HRI0060508QCS1 Western Blot analysis of APPL expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — APPL1
Entrez GeneID
26060GeneBank Accession#
NM_012096Protein Accession#
NP_036228Gene Name
APPL1
Gene Alias
APPL, DIP13alpha
Gene Description
adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1
Omim ID
604299Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A, DCC, AKT2, PIK3CA, adiponectin receptors, and proteins of the NuRD/MeCP1 complex. This protein is found associated with endosomal membranes, but can be released by EGF and translocated to the nucleus. [provided by RefSeq
Other Designations
AKT2 interactor|adaptor protein containing pH domain, PTB domain and leucine zipper motif 1|signaling adaptor protein DIP13alpha
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com