PRDX5 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
PRDX5 MaxPab polyclonal antibody. Western Blot analysis of PRDX5 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of PRDX5 expression in transfected 293T cell line (H00025824-T01) by PRDX5 MaxPab polyclonal antibody.
Lane 1: PRDX5 transfected lysate(23.54 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PRDX5 protein.
Immunogen
PRDX5 (NP_036226.1, 1 a.a. ~ 214 a.a) full-length human protein.
Sequence
MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (79)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PRDX5 MaxPab polyclonal antibody. Western Blot analysis of PRDX5 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of PRDX5 expression in transfected 293T cell line (H00025824-T01) by PRDX5 MaxPab polyclonal antibody.
Lane 1: PRDX5 transfected lysate(23.54 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — PRDX5
Entrez GeneID
25824GeneBank Accession#
NM_012094.3Protein Accession#
NP_036226.1Gene Name
PRDX5
Gene Alias
ACR1, AOEB166, B166, MGC117264, MGC142283, MGC142285, PLP, PMP20, PRDX6, PRXV, SBBI10
Gene Description
peroxiredoxin 5
Omim ID
606583Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms. Three transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
Alu co-repressor 1|TPx type VI|antioxidant enzyme B166|liver tissue 2D-page spot 71B|peroxisomal antioxidant enzyme|thioredoxin peroxidase PMP20
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com