PRDX5 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
PRDX5 polyclonal antibody (A01), Lot # 051109JC01 Western Blot analysis of PRDX5 expression in HL-60 ( Cat # L014V1 ).
Western Blot detection against Immunogen (38.21 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant PRDX5.
Immunogen
PRDX5 (NP_036226, 105 a.a. ~ 214 a.a) partial recombinant protein with GST tag.
Sequence
LPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (84); Rat (79)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.21 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
PRDX5 polyclonal antibody (A01), Lot # 051109JC01 Western Blot analysis of PRDX5 expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — PRDX5
Entrez GeneID
25824GeneBank Accession#
NM_012094Protein Accession#
NP_036226Gene Name
PRDX5
Gene Alias
ACR1, AOEB166, B166, MGC117264, MGC142283, MGC142285, PLP, PMP20, PRDX6, PRXV, SBBI10
Gene Description
peroxiredoxin 5
Omim ID
606583Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms. Three transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
Other Designations
Alu co-repressor 1|TPx type VI|antioxidant enzyme B166|liver tissue 2D-page spot 71B|peroxisomal antioxidant enzyme|thioredoxin peroxidase PMP20
-
Interactome
-
Disease
-
Publication Reference
-
Glutathione-dependent and -independent oxidative stress-control mechanisms distinguish normal human mammary epithelial cell subsets.
Kannan N, Nguyen LV, Makarem M, Dong Y, Shih K, Eirew P, Raouf A, Emerman JT, Eaves CJ.
PNAS 2014 May; 111(21):7789.
Application：WB-Ce, Human, Human mammary cells.
-
TNF-related apoptosis-inducing ligand suppresses PRDX4 expression.
Wang HQ, Du ZX, Liu BQ, Gao YY, Meng X, Guan Y, Zhang HY.
FEBS Letters 2009 May; 583(9):1511.
Application：WB-Ce, Human, HeLa cells.
-
Glutathione-dependent and -independent oxidative stress-control mechanisms distinguish normal human mammary epithelial cell subsets.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com