WBP2 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of WBP2 expression in transfected 293T cell line (H00023558-T02) by WBP2 MaxPab polyclonal antibody.
Lane 1: WBP2 transfected lysate(28.71 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human WBP2 protein.
Immunogen
WBP2 (NP_036610.2, 1 a.a. ~ 261 a.a) full-length human protein.
Sequence
MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQVASQASRGEVPSGAYGYSYMPSGAYVYPPPVANGMYPCPPGYPYPPPPPEFYPGPPMMDGAMGYVQPPPPPYPGPMEPPVSGPDVPSTPAAEAKAAEAAASAYYNPGNPHNVYMPTSQPPPPPYYPPEDKKTQ
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (96)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of WBP2 expression in transfected 293T cell line (H00023558-T02) by WBP2 MaxPab polyclonal antibody.
Lane 1: WBP2 transfected lysate(28.71 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — WBP2
Entrez GeneID
23558GeneBank Accession#
NM_012478.3Protein Accession#
NP_036610.2Gene Name
WBP2
Gene Alias
MGC18269, WBP-2
Gene Description
WW domain binding protein 2
Omim ID
606962Gene Ontology
HyperlinkGene Summary
The globular WW domain is composed of 38 to 40 semiconserved amino acids shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is involved in mediating protein-protein interactions through the binding of polyproline ligands. This gene encodes a WW domain binding protein, which binds to the WW domain of Yes kinase-associated protein by its PY motifs. The function of this protein has not been determined. [provided by RefSeq
Other Designations
-
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com