SIRT5 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SIRT5 protein.
Immunogen
SIRT5 (NP_036373.1, 1 a.a. ~ 310 a.a) full-length human protein.
Sequence
MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (85)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of SIRT5 expression in transfected 293T cell line (H00023408-T01) by SIRT5 MaxPab polyclonal antibody.
Lane 1: SIRT5 transfected lysate(34.1 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — SIRT5
Entrez GeneID
23408GeneBank Accession#
NM_012241.2Protein Accession#
NP_036373.1Gene Name
SIRT5
Gene Alias
FLJ36950, SIR2L5
Gene Description
sirtuin (silent mating type information regulation 2 homolog) 5 (S. cerevisiae)
Omim ID
604483Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in two transcript variants. [provided by RefSeq
Other Designations
OTTHUMP00000016054|OTTHUMP00000016055|silent mating type information regulation 2, S.cerevisiae, homolog 5|sir2-like 5|sirtuin 5|sirtuin type 5
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com