UBR2 MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of UBR2 expression in transfected 293T cell line (H00023304-T01) by UBR2 MaxPab polyclonal antibody.
Lane 1: UBR2 transfected lysate(48.29 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human UBR2 protein.
Immunogen
UBR2 (AAH64512.1, 1 a.a. ~ 439 a.a) full-length human protein.
Sequence
MASELEPEVQAIDRSLLECSAEEIAGKWLQATDLTREVYQHLAHYVPKIYCRGPNPFPQKEDMLAQHVLLGPMEWYLCGEDPAFGFPKLEQANKPSHLCGRVFKVGEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTTSGGGGFCDCGDTEAWKEGPYCQKHELNTSEIEEEEDPLVHLSEDVIARTYNIFAITFRYAVEILTWEKESELPADLEMVEKSDTYYCMLFNDEVHTYEQVIYTLQKAVNCTQKEAIGFATTVDRDGRRSVRYGDFQYCEQAKSVIVRNTSRQTKPLKVQVMHSSIVAHQNFGLKLLSWLGSIIGYSDGLRRILCQVGLQEGPDGENSSLVDRLMLSDSKLWKGARSVYHQLFMSSLLMDLKYKKLFAVRFAKNYERLQSDYVTDDHDREFSVADLSVQIFTVPSLFSISAGRSGSPL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of UBR2 expression in transfected 293T cell line (H00023304-T01) by UBR2 MaxPab polyclonal antibody.
Lane 1: UBR2 transfected lysate(48.29 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — UBR2
Entrez GeneID
23304GeneBank Accession#
BC064512.1Protein Accession#
AAH64512.1Gene Name
UBR2
Gene Alias
C6orf133, DKFZp686C08114, KIAA0349, MGC71112, RP3-392M17.3, bA49A4.1, dJ242G1.1, dJ392M17.3
Gene Description
ubiquitin protein ligase E3 component n-recognin 2
Omim ID
609134Gene Ontology
HyperlinkGene Summary
Proteolysis by the ubiquitin-proteasome system controls the concentration of many regulatory proteins. The selectivity of ubiquitylation is determined by ubiquitin E3 ligases, which recognize the substrate's destabilization signal, or degron. The E3 ligase UBR2 participates in the N-end rule pathway, which targets proteins bearing an N-terminal degron, or N-degron (Kwon et al., 2003 [PubMed 14585983]).[supplied by OMIM
Other Designations
OTTHUMP00000016403|OTTHUMP00000016405|OTTHUMP00000039767|OTTHUMP00000039768|ubiquitin ligase E3 alpha-II
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com