DAAM1 monoclonal antibody (M03), clone 4H3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant DAAM1.
Immunogen
DAAM1 (NP_055807, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQL
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (97); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
DAAM1 monoclonal antibody (M03), clone 4H3. Western Blot analysis of DAAM1 expression in A-431 ( Cat # L015V1 ).Western Blot (Cell lysate)
DAAM1 monoclonal antibody (M03), clone 4H3. Western Blot analysis of DAAM1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of DAAM1 expression in transfected 293T cell line by DAAM1 monoclonal antibody (M03), clone 4H3.
Lane 1: DAAM1 transfected lysate(122.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged DAAM1 is approximately 1ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between RHOA and DAAM1. HeLa cells were stained with anti-RHOA rabbit purified polyclonal 1:1200 and anti-DAAM1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — DAAM1
Entrez GeneID
23002GeneBank Accession#
NM_014992Protein Accession#
NP_055807Gene Name
DAAM1
Gene Alias
FLJ41657, KIAA0666
Gene Description
dishevelled associated activator of morphogenesis 1
Omim ID
606626Gene Ontology
HyperlinkGene Summary
Functions of the cell cortex, including motility, adhesion, and cytokinesis, are mediated by the reorganization of the actin cytoskeleton and recent evidence suggests a role for the Formin homology (FH) proteins in these processes. The protein encoded by this gene contains FH domains and belongs to a novel FH protein subfamily implicated in cell polarity. Wnt/Fz signaling activates the small GTPase Rho, a key regulator of cytoskeleton architecture, to control cell polarity and movement during development. Activation requires Dvl-Rho complex formation, an assembly mediated by this gene product, which is thought to function as a scaffolding protein. Evidence of alternative splicing has been observed for this gene but the full-length nature of these variants has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000179033|dishevelled-associated activator of morphogenesis 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com