MAPRE1 MaxPab mouse polyclonal antibody (B01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human MAPRE1 protein.
Immunogen
MAPRE1 (NP_036457, 1 a.a. ~ 268 a.a) full-length human protein.
Sequence
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (97); Rat (96)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Note
For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
-
Applications
Western Blot (Cell lysate)
MAPRE1 MaxPab polyclonal antibody. Western Blot analysis of MAPRE1 expression in Raw 264.7.Western Blot (Cell lysate)
MAPRE1 MaxPab polyclonal antibody. Western Blot analysis of MAPRE1 expression in PC-12.Western Blot (Cell lysate)
MAPRE1 MaxPab polyclonal antibody. Western Blot analysis of MAPRE1 expression in NIH/3T3.Western Blot (Cell lysate)
MAPRE1 MaxPab polyclonal antibody. Western Blot analysis of MAPRE1 expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of MAPRE1 expression in transfected 293T cell line (H00022919-T01) by MAPRE1 MaxPab polyclonal antibody.
Lane 1: MAPRE1 transfected lysate(29.48 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — MAPRE1
Entrez GeneID
22919GeneBank Accession#
NM_012325Protein Accession#
NP_036457Gene Name
MAPRE1
Gene Alias
EB1, MGC117374, MGC129946
Gene Description
microtubule-associated protein, RP/EB family, member 1
Omim ID
603108Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. During mitosis, the protein is associated with the centrosomes and spindle microtubules. The protein also associates with components of the dynactin complex and the intermediate chain of cytoplasmic dynein. Because of these associations, it is thought that this protein is involved in the regulation of microtubule structures and chromosome stability. This gene is a member of the RP/EB family. [provided by RefSeq
Other Designations
OTTHUMP00000030608|adenomatous polyposis coli-binding protein EB1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com