ICK polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length recombinant ICK.
Immunogen
ICK (AAH35807, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag.
Sequence
MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQVFFHFLVITFISNSE
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (58.23 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ICK polyclonal antibody (A01), Lot # 051103JC01 Western Blot analysis of ICK expression in Y-79 ( Cat # L042V1 ).Western Blot (Cell lysate)
ICK polyclonal antibody (A01), Lot # CAO0060412QCS1. Western Blot analysis of ICK expression in NIH/3T3.Western Blot (Recombinant protein)
ELISA
-
Gene Info — ICK
Entrez GeneID
22858GeneBank Accession#
BC035807Protein Accession#
AAH35807Gene Name
ICK
Gene Alias
KIAA0936, LCK2, MGC46090, MRK
Gene Description
intestinal cell (MAK-like) kinase
Gene Ontology
HyperlinkGene Summary
Eukaryotic protein kinases are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. This gene encodes an intestinal serine/threonine kinase harboring a dual phosphorylation site found in mitogen-activating protein (MAP) kinases. The protein localizes to the intestinal crypt region and is thought to be important in intestinal epithelial cell proliferation and differentiation. Alternative splicing has been observed at this locus and two variants, encoding the same isoform, have been identified. [provided by RefSeq
Other Designations
MAK-related kinase|OTTHUMP00000016630|OTTHUMP00000039961|intestinal cell kinase|serine/threonine protein kinase
-
Interactome
-
Disease
-
Publication Reference
-
KLC3 Regulates Ciliary Trafficking and Cyst Progression in CILK1 Deficiency-Related Polycystic Kidney Disease.
Gyuyeong Rah, Hwayeon Cha, Joohee Kim, Jieun Song, Hyunho Kim, Yun Kyu Oh, Curie Ahn, Minyong Kang, Jongmin Kim, Kyung Hyun Yoo, Min Jung Kim, Hyuk Wan Ko, Je Yeong Ko, and Jong Hoon Park.
Journal of the American Society of Nephrology 2022 Aug; ASN:2021111455.
Application:IF, Human, Human kidney.
-
A Novel Protein Kinase from the Ciliate Euplotes raikovi with Close Structural Identity to the Mammalian Intestinal and Male-Germ Cell Kinases: Characterization and Functional Implications in the Autocrine Pheromone Signaling Loop.
Vallesi A, Di Pretoro B, Ballarini P, Apone F, Luporini P.
Protist 2010 Apr; 161(2):250.
Application:IF, WB, Protozoa, Ciliate Euplotes raikovi.
-
KLC3 Regulates Ciliary Trafficking and Cyst Progression in CILK1 Deficiency-Related Polycystic Kidney Disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com