ADAM29 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot detection against Immunogen (32.71 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant ADAM29.
Immunogen
ADAM29 (NP_055084, 339 a.a. ~ 398 a.a) partial recombinant protein with GST tag.
Sequence
GMNHDEDTCRCSQPRCIMHEGNPPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (58)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.71 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — ADAM29
Entrez GeneID
11086GeneBank Accession#
NM_014269Protein Accession#
NP_055084Gene Name
ADAM29
Gene Alias
svph1
Gene Description
ADAM metallopeptidase domain 29
Omim ID
604778Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is highly expressed in testis and may be involved in human spermatogenesis. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq
Other Designations
a disintegrin and metalloproteinase domain 29
-
Publication Reference
-
Clinical significance of ADAM29 promoting the invasion and growth of gastric cancer cells in vitro.
Chen H, Wang S.
Oncology Letters 2018 Aug; 16(2):1483.
Application：IHC-P, WB-Tr, Human, AGS, MGC803 cells, Human gastric tissue samples.
-
Clinical significance of ADAM29 promoting the invasion and growth of gastric cancer cells in vitro.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com