NUDT21 monoclonal antibody (M01), clone 2G4-6F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant NUDT21.
Immunogen
NUDT21 (AAH01403, 1 a.a. ~ 227 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NUDT21 monoclonal antibody (M01), clone 2G4-6F11. Western Blot analysis of NUDT21 expression in human kidney.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NUDT21 is approximately 1ng/ml as a capture antibody.ELISA
-
Gene Info — NUDT21
Entrez GeneID
11051GeneBank Accession#
BC001403Protein Accession#
AAH01403Gene Name
NUDT21
Gene Alias
CFIM25, CPSF5, DKFZp686H1588
Gene Description
nudix (nucleoside diphosphate linked moiety X)-type motif 21
Omim ID
604978Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides. [provided by RefSeq
Other Designations
cleavage and polyadenylation specific factor 5|cleavage and polyadenylation specific factor 5, 25 kD subunit|cleavage and polyadenylation specific factor 5, 25 kDa|pre-mRNA cleavage factor Im (25kD)|pre-mRNA cleavage factor Im, 25kD subunit
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com