MAPRE2 monoclonal antibody (M03), clone 4D7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
MAPRE2 monoclonal antibody (M03), clone 4D7 Western Blot analysis of MAPRE2 expression in K-562 ( Cat # L009V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of MAPRE2 expression in transfected 293T cell line by MAPRE2 monoclonal antibody (M03), clone 4D7.
Lane 1: MAPRE2 transfected lysate (Predicted MW: 37 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MAPRE2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
Immunofluorescence
Immunofluorescence of monoclonal antibody to MAPRE2 on HeLa cell. [antibody concentration 35 ug/ml]
Western Blot detection against Immunogen (32.93 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MAPRE2.
Immunogen
MAPRE2 (NP_055083, 1 a.a. ~ 62 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHD
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.93 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
MAPRE2 monoclonal antibody (M03), clone 4D7 Western Blot analysis of MAPRE2 expression in K-562 ( Cat # L009V1 ).Western Blot (Transfected lysate)
Western Blot analysis of MAPRE2 expression in transfected 293T cell line by MAPRE2 monoclonal antibody (M03), clone 4D7.
Lane 1: MAPRE2 transfected lysate (Predicted MW: 37 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to MAPRE2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to MAPRE2 on HeLa cell. [antibody concentration 35 ug/ml] -
Gene Info — MAPRE2
Entrez GeneID
10982GeneBank Accession#
NM_014268Protein Accession#
NP_055083Gene Name
MAPRE2
Gene Alias
EB1, EB2, RP1
Gene Description
microtubule-associated protein, RP/EB family, member 2
Omim ID
605789Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family. The function of this protein is unknown; however, its homology suggests involvement in tumorigenesis of colorectal cancers and proliferative control of normal cells. This gene may belong to the intermediate/early gene family, involved in the signal transduction cascade downstream of the TCR. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
APC-binding protein EB1|T-cell activation protein, EB1 family
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com