STIP1 monoclonal antibody (M11), clone 1E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant STIP1.
Immunogen
STIP1 (NP_006810.1, 445 a.a. ~ 543 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
STIP1 monoclonal antibody (M11), clone 1E3. Western Blot analysis of STIP1 expression in NIH/3T3 ( Cat # L018V1 ).Western Blot (Cell lysate)
STIP1 monoclonal antibody (M11), clone 1E3. Western Blot analysis of STIP1 expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
STIP1 monoclonal antibody (M11), clone 1E3 Western Blot analysis of STIP1 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
STIP1 monoclonal antibody (M11), clone 1E3. Western Blot analysis of STIP1 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged STIP1 is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — STIP1
Entrez GeneID
10963GeneBank Accession#
NM_006819Protein Accession#
NP_006810.1Gene Name
STIP1
Gene Alias
HOP, IEF-SSP-3521, P60, STI1, STI1L
Gene Description
stress-induced-phosphoprotein 1
Omim ID
605063Gene Ontology
HyperlinkGene Summary
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]).[supplied by OMIM
Other Designations
Hsp70/Hsp90-organizing protein|stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Glaucoma-associated WDR36 variants encode functional defects in a yeast model system.
Footz TK, Johnson JL, Dubois S, Boivin N, Raymond V, Walter MA.
Human Molecular Genetics 2009 Apr; 18(7):1276.
Application:WB-Ce, Human, Monkey, Rat, COS-7, NPCE, HTM, RGC5 cells.
-
Glaucoma-associated WDR36 variants encode functional defects in a yeast model system.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com