SUGT1 monoclonal antibody (M04), clone 1A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SUGT1.
Immunogen
SUGT1 (NP_006695, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVG
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (86); Rat (86)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SUGT1 monoclonal antibody (M04), clone 1A10. Western Blot analysis of SUGT1 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Cell lysate)
SUGT1 monoclonal antibody (M04), clone 1A10. Western Blot analysis of SUGT1 expression in PC-12(Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of SUGT1 expression in transfected 293T cell line by SUGT1 monoclonal antibody (M04), clone 1A10.
Lane 1: SUGT1 transfected lysate (Predicted MW: 37.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of SUGT1 transfected lysate using anti-SUGT1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SUGT1 monoclonal antibody.ELISA
-
Gene Info — SUGT1
Entrez GeneID
10910GeneBank Accession#
NM_006704Protein Accession#
NP_006695Gene Name
SUGT1
Gene Alias
SGT1
Gene Description
SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae)
Omim ID
604098Gene Ontology
HyperlinkGene Summary
This gene is homologous to the yeast gene SGT1, which encodes a protein involved in kinetochore function and required for the G1/S and G2/M transitions. Complementation studies suggest that the human protein has similar functions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000040878|OTTHUMP00000178679|SGT1B protein|suppressor of G2 allele of SKP1|suppressor of G2 allele of SKP1, S. cerevisiae, homolog of
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com