NUP50 monoclonal antibody (M01), clone 4H7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NUP50 monoclonal antibody (M01), clone 4H7. Western Blot analysis of NUP50 expression in Hela S3 NE.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NUP50 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.52 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NUP50.
Immunogen
NUP50 (NP_705931.1, 342 a.a. ~ 439 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKD
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NUP50 monoclonal antibody (M01), clone 4H7. Western Blot analysis of NUP50 expression in Hela S3 NE.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NUP50 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — NUP50
Entrez GeneID
10762GeneBank Accession#
NM_153645Protein Accession#
NP_705931.1Gene Name
NUP50
Gene Alias
MGC39961, NPAP60, NPAP60L
Gene Description
nucleoporin 50kDa
Omim ID
604646Gene Ontology
HyperlinkGene Summary
The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000028685|nuclear pore-associated protein 60L
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com